Lineage for d2ja7q2 (2ja7 Q:144-215)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727252Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 727253Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (1 family) (S)
  5. 727254Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 727255Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species)
  7. 727256Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (25 PDB entries)
  8. 727274Domain d2ja7q2: 2ja7 Q:144-215 [138212]
    Other proteins in same PDB: d2ja7a1, d2ja7b1, d2ja7c1, d2ja7c2, d2ja7d1, d2ja7e1, d2ja7f1, d2ja7g1, d2ja7g2, d2ja7h1, d2ja7i1, d2ja7i2, d2ja7j1, d2ja7k1, d2ja7l1, d2ja7m1, d2ja7n1, d2ja7o1, d2ja7o2, d2ja7p1, d2ja7q1, d2ja7r1, d2ja7s1, d2ja7s2, d2ja7t1, d2ja7u1, d2ja7u2, d2ja7v1, d2ja7w1, d2ja7x1
    automatically matched to d1dzfa2
    complexed with bru, mg, tt, zn

Details for d2ja7q2

PDB Entry: 2ja7 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex c
PDB Compounds: (Q:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOP Domain Sequences for d2ja7q2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja7q2 d.78.1.1 (Q:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOP Domain Coordinates for d2ja7q2:

Click to download the PDB-style file with coordinates for d2ja7q2.
(The format of our PDB-style files is described here.)

Timeline for d2ja7q2: