Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily) core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) automatically mapped to Pfam PF01191 |
Family d.78.1.1: RPB5 [55288] (2 proteins) |
Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (27 PDB entries) Uniprot P20434; part of multichain biological unit |
Domain d2ja5e2: 2ja5 E:144-215 [138164] Other proteins in same PDB: d2ja5a1, d2ja5b1, d2ja5c1, d2ja5c2, d2ja5d1, d2ja5e1, d2ja5f1, d2ja5g1, d2ja5g2, d2ja5h1, d2ja5i1, d2ja5i2, d2ja5j1, d2ja5k1, d2ja5l1 automatically matched to d1dzfa2 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 2ja5 (more details), 3.8 Å
SCOPe Domain Sequences for d2ja5e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ja5e2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse tsgryasyricm
Timeline for d2ja5e2: