SCOPe 2.08: Domain d2ja5f1: 2ja5 F:72-155

Lineage for d2ja5f1 (2ja5 F:72-155)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.2: RPB6 [55294] (2 proteins)

6. Protein RPB6 [55295] (3 species)
   essential subunit of RNA polymerases I, II and III

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (31 PDB entries)
   Uniprot P20435; part of multichain biological unit

8. Domain d2ja5f1: 2ja5 F:72-155 [138165]
   Other proteins in same PDB: d2ja5a1, d2ja5b1, d2ja5c1, d2ja5c2, d2ja5d1, d2ja5e1, d2ja5e2, d2ja5g1, d2ja5g2, d2ja5h1, d2ja5i1, d2ja5i2, d2ja5j1, d2ja5k1, d2ja5l1
   automatically matched to d1i3qf_
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja5f1

PDB Entry: 2ja5, 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex a

PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III subunit RPABC2

SCOPe Domain Sequences for d2ja5f1:

Sequence; same for both SEQRES and ATOM records:

>d2ja5f1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

Timeline for d2ja5f1:

• d2ja5f1 first appeared in SCOP 1.73
  
• d2ja5f1 appears in SCOPe 2.07