SCOPe 2.07: Domain d2j9aa2: 2j9a A:1-159

Lineage for d2j9aa2 (2j9a A:1-159)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.0: automated matches [191326] (1 protein)
   not a true family

6. Protein automated matches [190146] (12 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255154] (2 PDB entries)

8. Domain d2j9aa2: 2j9a A:1-159 [138150]
   Other proteins in same PDB: d2j9aa1
   automated match to d1lama2
   complexed with ahy, cl, dms, mpd, zn

Details for d2j9aa2

PDB Entry: 2j9a, 1.73 Å

PDB Description: bllap in complex with microginin fr1

PDB Compounds: (A:) cytosol aminopeptidase

SCOPe Domain Sequences for d2j9aa2:

Sequence; same for both SEQRES and ATOM records:

>d2j9aa2 c.50.1.0 (A:1-159) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tkglvlgiyskekeedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhed
fpsvvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaa
egavlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl

Timeline for d2j9aa2:

• d2j9aa2 first appeared in SCOP 1.73
  
• d2j9aa2 appears in SCOPe 2.06
  
• d2j9aa2 appears in the current release, SCOPe 2.08