Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.321: STIV B116-like [143601] (1 superfamily) subunit fold consists of mixed 5-stranded beta-sheet, order:31452, strand 5 is antiparallel to the rest, with 3 helices on one side; dimerises with the formation of a single 10-stranded beta-sheet; strand 2 is in the dimer interface |
Superfamily d.321.1: STIV B116-like [143602] (2 families) |
Family d.321.1.1: STIV B116-like [143603] (3 proteins) automatically mapped to Pfam PF08960 |
Protein Hypothetical protein B116 [143604] (1 species) |
Species Sulfolobus turreted icosahedral virus, STIV [TaxId:269145] [143605] (1 PDB entry) Uniprot Q6Q0K9 2-116 |
Domain d2j85a1: 2j85 A:2-116 [138133] Other proteins in same PDB: d2j85a2, d2j85b2, d2j85b3 |
PDB Entry: 2j85 (more details), 2.39 Å
SCOPe Domain Sequences for d2j85a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j85a1 d.321.1.1 (A:2-116) Hypothetical protein B116 {Sulfolobus turreted icosahedral virus, STIV [TaxId: 269145]} gkvfltnafsinmlkefpttitidkldeedfclklelrledgtlinaighdstinlvntl cgtqlqknrvevkmnegdealiimisqrleegkvlsdkeikdmyrqgkisfyevw
Timeline for d2j85a1: