![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.321: STIV B116-like [143601] (1 superfamily) subunit fold consists of mixed 5-stranded beta-sheet, order:31452, strand 5 is antiparallel to the rest, with 3 helices on one side; dimerises with the formation of a single 10-stranded beta-sheet; strand 2 is in the dimer interface |
![]() | Superfamily d.321.1: STIV B116-like [143602] (1 family) ![]() |
![]() | Family d.321.1.1: STIV B116-like [143603] (2 proteins) |
![]() | Protein Hypothetical protein B116 [143604] (1 species) |
![]() | Species Sulfolobus turreted icosahedral virus, STIV [TaxId:269145] [143605] (1 PDB entry) |
![]() | Domain d2j85a1: 2j85 A:2-116 [138133] |
PDB Entry: 2j85 (more details), 2.39 Å
SCOP Domain Sequences for d2j85a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j85a1 d.321.1.1 (A:2-116) Hypothetical protein B116 {Sulfolobus turreted icosahedral virus, STIV [TaxId: 269145]} gkvfltnafsinmlkefpttitidkldeedfclklelrledgtlinaighdstinlvntl cgtqlqknrvevkmnegdealiimisqrleegkvlsdkeikdmyrqgkisfyevw
Timeline for d2j85a1: