SCOPe 2.03: Domain d2j7pe1: 2j7p E:27-78

Lineage for d2j7pe1 (2j7p E:27-78)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal recognition particle receptor, FtsY [47368] (3 species)

7. Species Thermus aquaticus [TaxId:271] [101122] (5 PDB entries)

8. Domain d2j7pe1: 2j7p E:27-78 [138125]
   Other proteins in same PDB: d2j7pa1, d2j7pa2, d2j7pb1, d2j7pb2, d2j7pd2, d2j7pe2
   automatically matched to d1okkd1
   protein/RNA complex; complexed with edo, gnp, iod, k, mg

Details for d2j7pe1

PDB Entry: 2j7p, 1.97 Å

PDB Description: gmppnp-stabilized ng domain complex of the srp gtpases ffh and ftsy

PDB Compounds: (E:) cell division protein ftsy

SCOPe Domain Sequences for d2j7pe1:

Sequence; same for both SEQRES and ATOM records:

>d2j7pe1 a.24.13.1 (E:27-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]}
nleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlep

Timeline for d2j7pe1:

• d2j7pe1 first appeared in SCOP 1.73
  
• d2j7pe1 appears in SCOPe 2.02
  
• d2j7pe1 appears in SCOPe 2.04
  
• d2j7pe1 appears in the current release, SCOPe 2.08