Class a: All alpha proteins [46456] (290 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) |
Family a.24.13.0: automated matches [229049] (1 protein) not a true family |
Protein automated matches [229050] (7 species) not a true protein |
Species Thermus aquaticus [TaxId:271] [255075] (4 PDB entries) |
Domain d2j7pe1: 2j7p E:27-78 [138125] Other proteins in same PDB: d2j7pa1, d2j7pa2, d2j7pb1, d2j7pb2, d2j7pd2, d2j7pe2 automated match to d1okkd1 protein/RNA complex; complexed with edo, gnp, iod, k, mg |
PDB Entry: 2j7p (more details), 1.97 Å
SCOPe Domain Sequences for d2j7pe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j7pe1 a.24.13.0 (E:27-78) automated matches {Thermus aquaticus [TaxId: 271]} nleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlep
Timeline for d2j7pe1: