Lineage for d2j7la1 (2j7l A:1-124)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937239Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 937240Family b.1.11.1: Pilus chaperone [49355] (5 proteins)
  6. 937289Protein Pilus chaperone PapD, N-domain [49356] (1 species)
    consists of two domains of this fold; domain 2 has an additional strand at the C-terminus
  7. 937290Species Escherichia coli [TaxId:562] [49357] (9 PDB entries)
  8. 937304Domain d2j7la1: 2j7l A:1-124 [138117]
    Other proteins in same PDB: d2j7la2
    automatically matched to d3dpa_1
    complexed with xc2

Details for d2j7la1

PDB Entry: 2j7l (more details), 2.6 Å

PDB Description: e.coli p pilus chaperone papd in complex with a pilus biogenesis inhibitor, pilicide 2c
PDB Compounds: (A:) chaperone protein papd

SCOPe Domain Sequences for d2j7la1:

Sequence, based on SEQRES records: (download)

>d2j7la1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrld
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrp

Sequence, based on observed residues (ATOM records): (download)

>d2j7la1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrld
pgaksmvrlsttpdisklpqdreslfyfnlreipprseqialqtkiklfyrpaaiktrp

SCOPe Domain Coordinates for d2j7la1:

Click to download the PDB-style file with coordinates for d2j7la1.
(The format of our PDB-style files is described here.)

Timeline for d2j7la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j7la2