Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (2 families) contains PP switch between strands D and C' |
Family b.1.11.1: Pilus chaperone [49355] (5 proteins) |
Protein Pilus chaperone PapD, N-domain [49356] (1 species) consists of two domains of this fold; domain 2 has an additional strand at the C-terminus |
Species Escherichia coli [TaxId:562] [49357] (9 PDB entries) |
Domain d2j7la1: 2j7l A:1-124 [138117] Other proteins in same PDB: d2j7la2 automatically matched to d3dpa_1 complexed with xc2 |
PDB Entry: 2j7l (more details), 2.6 Å
SCOP Domain Sequences for d2j7la1:
Sequence, based on SEQRES records: (download)
>d2j7la1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]} avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrld pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai ktrp
>d2j7la1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]} avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrld pgaksmvrlsttpdisklpqdreslfyfnlreipprseqialqtkiklfyrpaaiktrp
Timeline for d2j7la1: