Lineage for d2j7db_ (2j7d B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)
  6. Protein automated matches [190245] (11 species)
    not a true protein
  7. Species Thermotoga maritima [TaxId:2336] [187021] (20 PDB entries)
  8. Domain d2j7db_: 2j7d B: [138108]
    automated match to d1od0b_
    complexed with act, ca, gi1

Details for d2j7db_

PDB Entry: 2j7d (more details), 2.24 Å

PDB Description: beta-glucosidase from thermotoga maritima in complex with methoxycarbonyl-substituted glucoimidazole
PDB Compounds: (B:) beta-glucosidase a

SCOPe Domain Sequences for d2j7db_:

Sequence, based on SEQRES records: (download)

>d2j7db_ c.1.8.4 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm
hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse
dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys
tqkrivkdsgywysnvvknngle

Sequence, based on observed residues (ATOM records): (download)

>d2j7db_ c.1.8.4 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm
hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
dpdaakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvsed
grvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdyst
qkrivkdsgywysnvvknngle

SCOPe Domain Coordinates for d2j7db_ are not available.

Timeline for d2j7db_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2j7da_