Lineage for d2j7db1 (2j7d B:3-445)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 683071Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (5 proteins)
  6. 683081Protein Beta-glucosidase A [51528] (7 species)
  7. 683121Species Thermotoga maritima [TaxId:2336] [89475] (22 PDB entries)
  8. 683157Domain d2j7db1: 2j7d B:3-445 [138108]
    automatically matched to d1od0b_
    complexed with act, ca, gi1

Details for d2j7db1

PDB Entry: 2j7d (more details), 2.24 Å

PDB Description: beta-glucosidase from thermotoga maritima in complex with methoxycarbonyl-substituted glucoimidazole
PDB Compounds: (B:) beta-glucosidase a

SCOP Domain Sequences for d2j7db1:

Sequence, based on SEQRES records: (download)

>d2j7db1 c.1.8.4 (B:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]}
vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm
hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse
dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys
tqkrivkdsgywysnvvknngle

Sequence, based on observed residues (ATOM records): (download)

>d2j7db1 c.1.8.4 (B:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]}
vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm
hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
dpdaakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvsed
grvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdyst
qkrivkdsgywysnvvknngle

SCOP Domain Coordinates for d2j7db1:

Click to download the PDB-style file with coordinates for d2j7db1.
(The format of our PDB-style files is described here.)

Timeline for d2j7db1: