SCOPe 2.01: Domain d2j6ca_: 2j6c A:

Lineage for d2j6ca_ (2j6c A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.321: STIV B116-like [143601] (1 superfamily)
   subunit fold consists of mixed 5-stranded beta-sheet, order:31452, strand 5 is antiparallel to the rest, with 3 helices on one side; dimerises with the formation of a single 10-stranded beta-sheet; strand 2 is in the dimer interface

4. Superfamily d.321.1: STIV B116-like [143602] (2 families)

5. Family d.321.1.1: STIV B116-like [143603] (3 proteins)

6. Protein Afv3-109 [143606] (1 species)

7. Species Acidianus filamentous virus 1 [TaxId:235266] [143607] (2 PDB entries)

8. Domain d2j6ca_: 2j6c A: [138079]
   automated match to d2j6ba1
   complexed with gol

Details for d2j6ca_

PDB Entry: 2j6c, 1.3 Å

PDB Description: crystal structure of afv3-109, a highly conserved protein from crenarchaeal viruses

PDB Compounds: (A:) afv3-109

SCOPe Domain Sequences for d2j6ca_:

Sequence; same for both SEQRES and ATOM records:

>d2j6ca_ d.321.1.1 (A:) Afv3-109 {Acidianus filamentous virus 1 [TaxId: 235266]}
mlyilnsailplkpgeeytvkakeitiqeakelvtkeqftsaighqataellssilgvnv
pmnrvqikvthgdrilafmlkqrlpegvvvktteelekigyelwlfeiq

Timeline for d2j6ca_:

• d2j6ca_ first appeared in SCOP 1.73, called d2j6ca1
  
• d2j6ca_ was called d2j6ca1 in SCOP 1.75
  
• d2j6ca_ appears in SCOPe 2.02
  
• d2j6ca_ appears in the current release, SCOPe 2.08