SCOP 1.75: Domain d2j6ca1: 2j6c A:1-109

Lineage for d2j6ca1 (2j6c A:1-109)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.321: STIV B116-like [143601] (1 superfamily)
   subunit fold consists of mixed 5-stranded beta-sheet, order:31452, strand 5 is antiparallel to the rest, with 3 helices on one side; dimerises with the formation of a single 10-stranded beta-sheet; strand 2 is in the dimer interface

4. Superfamily d.321.1: STIV B116-like [143602] (1 family)

5. Family d.321.1.1: STIV B116-like [143603] (2 proteins)

6. Protein Afv3-109 [143606] (1 species)

7. Species Acidianus filamentous virus 1 [TaxId:235266] [143607] (2 PDB entries)

8. Domain d2j6ca1: 2j6c A:1-109 [138079]
   automatically matched to 2J6B A:1-109
   complexed with gol

Details for d2j6ca1

PDB Entry: 2j6c, 1.3 Å

PDB Description: crystal structure of afv3-109, a highly conserved protein from crenarchaeal viruses

PDB Compounds: (A:) afv3-109

SCOP Domain Sequences for d2j6ca1:

Sequence; same for both SEQRES and ATOM records:

>d2j6ca1 d.321.1.1 (A:1-109) Afv3-109 {Acidianus filamentous virus 1 [TaxId: 235266]}
mlyilnsailplkpgeeytvkakeitiqeakelvtkeqftsaighqataellssilgvnv
pmnrvqikvthgdrilafmlkqrlpegvvvktteelekigyelwlfeiq

Timeline for d2j6ca1:

• d2j6ca1 first appeared in SCOP 1.73
  
• d2j6ca1 is called d2j6ca_ in SCOPe 2.01
  
• d2j6ca1 appears in the current release, SCOPe 2.08, called d2j6ca_