SCOP 1.73: Domain d2j4zb1: 2j4z B:126-388

Lineage for d2j4zb1 (2j4z B:126-388)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
   OPK group; AIRK subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [90039] (7 PDB entries)

8. Domain d2j4zb1: 2j4z B:126-388 [138010]
   automatically matched to d1ol5a_
   complexed with 626, ars

Details for d2j4zb1

PDB Entry: 2j4z, 2 Å

PDB Description: structure of aurora-2 in complex with pha-680626

PDB Compounds: (B:) serine threonine-protein kinase 6

SCOP Domain Sequences for d2j4zb1:

Sequence; same for both SEQRES and ATOM records:

>d2j4zb1 d.144.1.7 (B:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrm
hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
hnpsqrpmlrevlehpwitanss

Timeline for d2j4zb1:

• d2j4zb1 is new in SCOP 1.73
  
• d2j4zb1 appears in SCOP 1.75
  
• d2j4zb1 appears in the current release, SCOPe 2.08, called d2j4zb_