Lineage for d2j4zb1 (2j4z B:126-388)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874358Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
    OPK group; AIRK subfamily; serine/threonine kinase
  7. 874359Species Human (Homo sapiens) [TaxId:9606] [90039] (8 PDB entries)
  8. 874361Domain d2j4zb1: 2j4z B:126-388 [138010]
    automatically matched to d1ol5a_
    complexed with 626, ars

Details for d2j4zb1

PDB Entry: 2j4z (more details), 2 Å

PDB Description: structure of aurora-2 in complex with pha-680626
PDB Compounds: (B:) serine threonine-protein kinase 6

SCOP Domain Sequences for d2j4zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j4zb1 d.144.1.7 (B:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrm
hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
hnpsqrpmlrevlehpwitanss

SCOP Domain Coordinates for d2j4zb1:

Click to download the PDB-style file with coordinates for d2j4zb1.
(The format of our PDB-style files is described here.)

Timeline for d2j4zb1: