SCOP 1.75: Domain d2j3wa1: 2j3w A:1-140

Lineage for d2j3wa1 (2j3w A:1-140)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.4: SNARE-like [64356] (4 families)
   beta(2)-alpha-beta(3)-alpha(2)

5. Family d.110.4.3: Sedlin (SEDL) [82767] (1 protein)

6. Protein Sedlin (SEDL) [82768] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [82769] (2 PDB entries)

8. Domain d2j3wa1: 2j3w A:1-140 [137981]
   Other proteins in same PDB: d2j3wb1, d2j3wf1
   automatically matched to d1h3qa_
   complexed with p1l

Details for d2j3wa1

PDB Entry: 2j3w, 2.1 Å

PDB Description: The crystal structure of the bet3-trs31-sedlin complex.

PDB Compounds: (A:) trafficking protein particle complex protein 2

SCOP Domain Sequences for d2j3wa1:

Sequence; same for both SEQRES and ATOM records:

>d2j3wa1 d.110.4.3 (A:1-140) Sedlin (SEDL) {Mouse (Mus musculus) [TaxId: 10090]}
msgsfyfvivghhdnpvfemeflppgkaeskddhrhlnqfiahaaldlvdenmwlsnnmy
lktvdkfnewfvsafvtaghmrfimlhdvrqedgiknfftdvydlyikfamnpfyepnsp
irssafdrkvqflgkkhlls

Timeline for d2j3wa1:

• d2j3wa1 first appeared in SCOP 1.73
  
• d2j3wa1 is called d2j3wa_ in SCOPe 2.01
  
• d2j3wa1 appears in the current release, SCOPe 2.08, called d2j3wa_