PDB entry 2j3w

View 2j3w on RCSB PDB site
Description: the crystal structure of the bet3-trs31-sedlin complex.
Class: vesicle transport
Keywords: multisubunit tethering factor, trapp, palmitate, transport, lipoprotein, er-golgi transport, endoplasmic reticulum, transcription, golgi apparatus, vesicle transport
Deposited on 2006-08-23, released 2006-11-27
The last revision prior to the SCOP 1.75 freeze date was dated 2006-11-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.23
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trafficking protein particle complex protein 2
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2j3wa1
  • Chain 'B':
    Compound: zgc 92866
    Species: Brachydanio rerio
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2j3wb1
  • Chain 'C':
    Compound: trafficking protein particle complex protein 2
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2j3wc1
  • Chain 'D':
    Compound: Trafficking protein particle complex subunit 3
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Trafficking protein particle complex subunit 3
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: zgc 92866
    Species: Brachydanio rerio
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2j3wf1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j3wA (A:)
    lemsgsfyfvivghhdnpvfemeflppgkaeskddhrhlnqfiahaaldlvdenmwlsnn
    mylktvdkfnewfvsafvtaghmrfimlhdvrqedgiknfftdvydlyikfamnpfyepn
    spirssafdrkvqflgkkhlls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j3wB (B:)
    mevrftrgksailersltrpktevsvsafallfsemvqycqsrvysvselqarladmgqg
    vgaslldvlvmrekngkretkvlnillfikvnvwkalfgkeadkleqandddktyyiiek
    eplinayisvpkenstlncaaftggiveailthsgfpakvtvhwhkgttlmikfdesvia
    rdkaldgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j3wB (B:)
    ktevsvsafallfsemvqycqsrvysvselqarladmgqgvgaslldvlvmrekngkret
    kvlnillfikvnvwkalfgkeadkleqandddktyyiiekeplinayisvpkenstlnca
    aftggiveailthsgfpakvtvhwhkgttlmikfdesviardkaldgr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j3wC (C:)
    lemsgsfyfvivghhdnpvfemeflppgkaeskddhrhlnqfiahaaldlvdenmwlsnn
    mylktvdkfnewfvsafvtaghmrfimlhdvrqedgiknfftdvydlyikfamnpfyepn
    spirssafdrkvqflgkkhlls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j3wC (C:)
    lemsgsfyfvivghhdnpvfemeflppgkrhlnqfiahaaldlvdenmwlsnnmylktvd
    kfnewfvsafvtaghmrfimlhdvrqedgiknfftdvydlyikfamnpfyepnspirssa
    fdrkvqflgkkhlls
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2j3wF (F:)
    mevrftrgksailersltrpktevsvsafallfsemvqycqsrvysvselqarladmgqg
    vgaslldvlvmrekngkretkvlnillfikvnvwkalfgkeadkleqandddktyyiiek
    eplinayisvpkenstlncaaftggiveailthsgfpakvtvhwhkgttlmikfdesvia
    rdkaldgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j3wF (F:)
    tevsvsafallfsemvqycqsrvysvselqarladmgqgvgaslldvlvmrekngkretk
    vlnillfikvnvwkalfgkeadkleqandddktyyiiekeplinayisvpkenstlncaa
    ftggiveailthsgfpakvtvhwhkgttlmikfdesviardkaldgr