Lineage for d2j3wc1 (2j3w C:1-140)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870642Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 870911Superfamily d.110.4: SNARE-like [64356] (4 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 870928Family d.110.4.3: Sedlin (SEDL) [82767] (1 protein)
  6. 870929Protein Sedlin (SEDL) [82768] (1 species)
  7. 870930Species Mouse (Mus musculus) [TaxId:10090] [82769] (2 PDB entries)
  8. 870932Domain d2j3wc1: 2j3w C:1-140 [137982]
    Other proteins in same PDB: d2j3wb1, d2j3wf1
    automatically matched to d1h3qa_
    complexed with p1l

Details for d2j3wc1

PDB Entry: 2j3w (more details), 2.1 Å

PDB Description: The crystal structure of the bet3-trs31-sedlin complex.
PDB Compounds: (C:) trafficking protein particle complex protein 2

SCOP Domain Sequences for d2j3wc1:

Sequence, based on SEQRES records: (download)

>d2j3wc1 d.110.4.3 (C:1-140) Sedlin (SEDL) {Mouse (Mus musculus) [TaxId: 10090]}
msgsfyfvivghhdnpvfemeflppgkaeskddhrhlnqfiahaaldlvdenmwlsnnmy
lktvdkfnewfvsafvtaghmrfimlhdvrqedgiknfftdvydlyikfamnpfyepnsp
irssafdrkvqflgkkhlls

Sequence, based on observed residues (ATOM records): (download)

>d2j3wc1 d.110.4.3 (C:1-140) Sedlin (SEDL) {Mouse (Mus musculus) [TaxId: 10090]}
msgsfyfvivghhdnpvfemeflppgkrhlnqfiahaaldlvdenmwlsnnmylktvdkf
newfvsafvtaghmrfimlhdvrqedgiknfftdvydlyikfamnpfyepnspirssafd
rkvqflgkkhlls

SCOP Domain Coordinates for d2j3wc1:

Click to download the PDB-style file with coordinates for d2j3wc1.
(The format of our PDB-style files is described here.)

Timeline for d2j3wc1: