![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.6: Ribosomal protein L19 [141245] (1 protein) Pfam PF01245 |
![]() | Protein Ribosomal protein L19 [141246] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [141247] (9 PDB entries) |
![]() | Domain d2j28p1: 2j28 P:1-114 [137966] Other proteins in same PDB: d2j2801, d2j2811, d2j2821, d2j2831, d2j2841, d2j28l1, d2j28m1, d2j28r1, d2j28u1, d2j28v1, d2j28x1, d2j28z1 automatically matched to 2AW4 P:1-114 complexed with mg |
PDB Entry: 2j28 (more details), 8 Å
SCOP Domain Sequences for d2j28p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j28p1 b.34.5.6 (P:1-114) Ribosomal protein L19 {Escherichia coli [TaxId: 562]} sniikqleqeqmkqdvpsfrpgdtvevkvwvvegskkrlqafegvviairnrglhsaftv rkisngegvervfqthspvvdsisvkrrgavrkaklyylrertgkaarikerln
Timeline for d2j28p1: