![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
![]() | Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) ![]() |
![]() | Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
![]() | Protein Ribosomal protein L15 (L15p) [52082] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [141994] (9 PDB entries) |
![]() | Domain d2j28l1: 2j28 L:1-144 [137964] Other proteins in same PDB: d2j2801, d2j2811, d2j2821, d2j2831, d2j2841, d2j28m1, d2j28p1, d2j28r1, d2j28u1, d2j28v1, d2j28x1, d2j28z1 automatically matched to 2AW4 L:1-144 complexed with mg |
PDB Entry: 2j28 (more details), 8 Å
SCOP Domain Sequences for d2j28l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j28l1 c.12.1.1 (L:1-144) Ribosomal protein L15 (L15p) {Escherichia coli [TaxId: 562]} mrlntlspaegskkagkrlgrgigsglgktggrghkgqksrsgggvrrgfeggqmplyrr lpkfgftsrkaaitaeirlsdlakveggvvdlntlkaaniigiqiefakvilagevttpv tvrglrvtkgaraaieaaggkiee
Timeline for d2j28l1: