Lineage for d2j0wa3 (2j0w A:386-449)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954208Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein)
    duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family
  6. 2954209Protein Aspartokinase [143391] (3 species)
  7. 2954210Species Escherichia coli [TaxId:562] [143393] (2 PDB entries)
    Uniprot P08660 295-385! Uniprot P08660 386-449
    Lysine-sensitive aspartokinase 3
  8. 2954212Domain d2j0wa3: 2j0w A:386-449 [137925]
    Other proteins in same PDB: d2j0wa1
    complexed with adp, asp, cl, mg

Details for d2j0wa3

PDB Entry: 2j0w (more details), 2.5 Å

PDB Description: crystal structure of e. coli aspartokinase iii in complex with aspartate and adp (r-state)
PDB Compounds: (A:) lysine-sensitive aspartokinase 3

SCOPe Domain Sequences for d2j0wa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0wa3 d.58.18.10 (A:386-449) Aspartokinase {Escherichia coli [TaxId: 562]}
lalvaligndlskacgvgkevfgvlepfnirmicygasshnlcflvpgedaeqvvqklhs
nlfe

SCOPe Domain Coordinates for d2j0wa3:

Click to download the PDB-style file with coordinates for d2j0wa3.
(The format of our PDB-style files is described here.)

Timeline for d2j0wa3: