SCOPe 2.08: Domain d2j0wa1: 2j0w A:3-294

Lineage for d2j0wa1 (2j0w A:3-294)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.3: PyrH-like [142721] (4 proteins)
   part of Pfam PF00696

6. Protein Aspartokinase [142724] (3 species)

7. Species Escherichia coli [TaxId:562] [142727] (2 PDB entries)
   Uniprot P08660 3-294
   Lysine-sensitive aspartokinase 3

8. Domain d2j0wa1: 2j0w A:3-294 [137923]
   Other proteins in same PDB: d2j0wa2, d2j0wa3
   complexed with adp, asp, cl, mg

Details for d2j0wa1

PDB Entry: 2j0w, 2.5 Å

PDB Description: crystal structure of e. coli aspartokinase iii in complex with aspartate and adp (r-state)

PDB Compounds: (A:) lysine-sensitive aspartokinase 3

SCOPe Domain Sequences for d2j0wa1:

Sequence; same for both SEQRES and ATOM records:

>d2j0wa1 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli [TaxId: 562]}
eivvskfggtsvadfdamnrsadivlsdanvrlvvlsasagitnllvalaeglepgerfe
kldairniqfailerlrypnvireeierllenitvlaeaaalatspaltdelvshgelms
tllfveilrerdvqaqwfdvrkvmrtndrfgraepdiaalaelaalqllprlneglvitq
gfigsenkgrtttlgrggsdytaallaealhasrvdiwtdvpgiyttdprvvsaakride
iafaeaaematfgakvlhpatllpavrsdipvfvgsskdpraggtlvcnkte

Timeline for d2j0wa1:

• d2j0wa1 first appeared in SCOP 1.73
  
• d2j0wa1 appears in SCOPe 2.07