PDB entry 2j0w

View 2j0w on RCSB PDB site
Description: crystal structure of e. coli aspartokinase III in complex with aspartate and ADP (r-state)
Class: transferase
Keywords: feedback inhibition, allosteric regulation, kinase, act domain, transferase, aspartokinase, amino acid biosynthesis, amino-acid biosynthesis, aspartate pathway, lysine biosynthesis
Deposited on 2006-08-07, released 2006-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.235
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysine-sensitive aspartokinase 3
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j0wa1, d2j0wa2, d2j0wa3
  • Heterogens: ASP, CL, ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j0wA (A:)
    mseivvskfggtsvadfdamnrsadivlsdanvrlvvlsasagitnllvalaeglepger
    fekldairniqfailerlrypnvireeierllenitvlaeaaalatspaltdelvshgel
    mstllfveilrerdvqaqwfdvrkvmrtndrfgraepdiaalaelaalqllprlneglvi
    tqgfigsenkgrtttlgrggsdytaallaealhasrvdiwtdvpgiyttdprvvsaakri
    deiafaeaaematfgakvlhpatllpavrsdipvfvgsskdpraggtlvcnktenpplfr
    alalrrnqtlltlhslnmlhsrgflaevfgilarhnisvdlittsevsvaltldttgsts
    tgdtlltqsllmelsalcrveveeglalvaligndlskacgvgkevfgvlepfnirmicy
    gasshnlcflvpgedaeqvvqklhsnlfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0wA (A:)
    eivvskfggtsvadfdamnrsadivlsdanvrlvvlsasagitnllvalaeglepgerfe
    kldairniqfailerlrypnvireeierllenitvlaeaaalatspaltdelvshgelms
    tllfveilrerdvqaqwfdvrkvmrtndrfgraepdiaalaelaalqllprlneglvitq
    gfigsenkgrtttlgrggsdytaallaealhasrvdiwtdvpgiyttdprvvsaakride
    iafaeaaematfgakvlhpatllpavrsdipvfvgsskdpraggtlvcnktenpplfral
    alrrnqtlltlhslnmlhsrgflaevfgilarhnisvdlittsevsvaltldttgststg
    dtlltqsllmelsalcrveveeglalvaligndlskacgvgkevfgvlepfnirmicyga
    sshnlcflvpgedaeqvvqklhsnlfe