SCOPe 2.01: Domain d2j09a2: 2j09 A:2-171

Lineage for d2j09a2 (2j09 A:2-171)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (1 family)

5. Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins)

6. Protein DNA photolyase [52427] (3 species)
   binds a light-harvesting cofactor

7. Species Thermus thermophilus [TaxId:274] [69460] (5 PDB entries)

8. Domain d2j09a2: 2j09 A:2-171 [137896]
   Other proteins in same PDB: d2j09a1
   automatically matched to d1iqra2
   complexed with cl, fad, fmn, po4

Details for d2j09a2

PDB Entry: 2j09, 2 Å

PDB Description: thermus dna photolyase with fmn antenna chromophore

PDB Compounds: (A:) deoxyribodipyrimidine photo-lyase

SCOPe Domain Sequences for d2j09a2:

Sequence; same for both SEQRES and ATOM records:

>d2j09a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]}
gpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralreay
rarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllpa
phllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpg

Timeline for d2j09a2:

• d2j09a2 first appeared in SCOP 1.73
  
• d2j09a2 appears in SCOP 1.75
  
• d2j09a2 appears in SCOPe 2.02
  
• d2j09a2 appears in the current release, SCOPe 2.08