SCOPe 2.01: Domain d2j09a1: 2j09 A:172-405

Lineage for d2j09a1 (2j09 A:172-405)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
   multihelical; consists of two all-alpha subdomains

4. Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (1 family)

5. Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (2 proteins)

6. Protein C-terminal domain of DNA photolyase [48175] (3 species)
   N-terminal domain is alpha/beta and binds a light-harvesting cofactor

7. Species Thermus thermophilus [TaxId:274] [69083] (5 PDB entries)

8. Domain d2j09a1: 2j09 A:172-405 [137895]
   Other proteins in same PDB: d2j09a2
   automatically matched to d1iqra1
   complexed with cl, fad, fmn, po4

Details for d2j09a1

PDB Entry: 2j09, 2 Å

PDB Description: thermus dna photolyase with fmn antenna chromophore

PDB Compounds: (A:) deoxyribodipyrimidine photo-lyase

SCOPe Domain Sequences for d2j09a1:

Sequence; same for both SEQRES and ATOM records:

>d2j09a1 a.99.1.1 (A:172-405) C-terminal domain of DNA photolyase {Thermus thermophilus [TaxId: 274]}
lplpepgeeaalaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweae
rrggegarkwvaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktg
vplvdaamrelhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgw
qwagglgvdaapyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdlee

Timeline for d2j09a1:

• d2j09a1 first appeared in SCOP 1.73
  
• d2j09a1 appears in SCOP 1.75
  
• d2j09a1 appears in SCOPe 2.02
  
• d2j09a1 appears in the current release, SCOPe 2.08