Lineage for d2iyld1 (2iyl D:21-78)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909860Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 910354Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) (S)
  5. 910355Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 910359Protein Signal recognition particle receptor, FtsY [47368] (3 species)
  7. 910366Species Thermus aquaticus [TaxId:271] [101122] (5 PDB entries)
  8. 910371Domain d2iyld1: 2iyl D:21-78 [137801]
    Other proteins in same PDB: d2iyld2
    automatically matched to d1okkd1
    protein/RNA complex; complexed with gdp, so4

Details for d2iyld1

PDB Entry: 2iyl (more details), 2.1 Å

PDB Description: structure of an ftsy:gdp complex
PDB Compounds: (D:) cell division protein ftsy

SCOPe Domain Sequences for d2iyld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iyld1 a.24.13.1 (D:21-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]}
aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlep

SCOPe Domain Coordinates for d2iyld1:

Click to download the PDB-style file with coordinates for d2iyld1.
(The format of our PDB-style files is described here.)

Timeline for d2iyld1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iyld2