SCOPe 2.08: Domain d2iyld1: 2iyl D:21-90

Lineage for d2iyld1 (2iyl D:21-90)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.0: automated matches [229049] (1 protein)
   not a true family

6. Protein automated matches [229050] (7 species)
   not a true protein

7. Species Thermus aquaticus [TaxId:271] [255075] (4 PDB entries)

8. Domain d2iyld1: 2iyl D:21-90 [137801]
   Other proteins in same PDB: d2iyld2
   automated match to d2cnwd1
   protein/RNA complex; complexed with gdp, so4

Details for d2iyld1

PDB Entry: 2iyl, 2.1 Å

PDB Description: structure of an ftsy:gdp complex

PDB Compounds: (D:) cell division protein ftsy

SCOPe Domain Sequences for d2iyld1:

Sequence, based on SEQRES records:

>d2iyld1 a.24.13.0 (D:21-90) automated matches {Thermus aquaticus [TaxId: 271]}
aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlepde
rratlrklgf

Sequence, based on observed residues (ATOM records):

>d2iyld1 a.24.13.0 (D:21-90) automated matches {Thermus aquaticus [TaxId: 271]}
aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlepda
tlrklgf

Timeline for d2iyld1:

• d2iyld1 first appeared in SCOP 1.73
  
• d2iyld1 appears in SCOPe 2.07