![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) ![]() |
![]() | Family a.24.13.0: automated matches [229049] (1 protein) not a true family |
![]() | Protein automated matches [229050] (7 species) not a true protein |
![]() | Species Thermus aquaticus [TaxId:271] [255075] (4 PDB entries) |
![]() | Domain d2iyld1: 2iyl D:21-90 [137801] Other proteins in same PDB: d2iyld2 automated match to d2cnwd1 protein/RNA complex; complexed with gdp, so4 |
PDB Entry: 2iyl (more details), 2.1 Å
SCOPe Domain Sequences for d2iyld1:
Sequence, based on SEQRES records: (download)
>d2iyld1 a.24.13.0 (D:21-90) automated matches {Thermus aquaticus [TaxId: 271]} aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlepde rratlrklgf
>d2iyld1 a.24.13.0 (D:21-90) automated matches {Thermus aquaticus [TaxId: 271]} aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlepda tlrklgf
Timeline for d2iyld1: