SCOPe 2.04: Domain d2ixlb_: 2ixl B:

Lineage for d2ixlb_ (2ixl B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)

6. Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
   synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase

7. Species Streptococcus suis [TaxId:1307] [89402] (4 PDB entries)

8. Domain d2ixlb_: 2ixl B: [137773]
   automated match to d1nzca_
   complexed with ni, trh

Details for d2ixlb_

PDB Entry: 2ixl, 1.6 Å

PDB Description: rmlc s. suis with dtdp-rhamnose

PDB Compounds: (B:) dtdp-4-dehydrorhamnose 3,5-epimerase

SCOPe Domain Sequences for d2ixlb_:

Sequence; same for both SEQRES and ATOM records:

>d2ixlb_ b.82.1.1 (B:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]}
enffgktlaarpveaipgmlefdipvhgdnrgwfkenfqkekmlplgfpesffaegklqn
nvsfsrknvlrglhaepwdkyisvadggkvlgtwvdlregetfgntyqtvidasksifvp
rgvangfqvlsdfvaysylvndywalelkpkyafvnyadpsldikwenleeaevseaden
hpflkdvkplrkedl

Timeline for d2ixlb_:

• d2ixlb_ first appeared in SCOP 1.73, called d2ixlb1
  
• d2ixlb_ appears in SCOPe 2.03
  
• d2ixlb_ appears in SCOPe 2.05
  
• d2ixlb_ appears in the current release, SCOPe 2.08