Lineage for d2ixlb_ (2ixl B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814472Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)
  6. 2814473Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
    synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
  7. 2814499Species Streptococcus suis [TaxId:1307] [89402] (4 PDB entries)
  8. 2814503Domain d2ixlb_: 2ixl B: [137773]
    automated match to d1nzca_
    complexed with ni, trh

Details for d2ixlb_

PDB Entry: 2ixl (more details), 1.6 Å

PDB Description: rmlc s. suis with dtdp-rhamnose
PDB Compounds: (B:) dtdp-4-dehydrorhamnose 3,5-epimerase

SCOPe Domain Sequences for d2ixlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ixlb_ b.82.1.1 (B:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]}
enffgktlaarpveaipgmlefdipvhgdnrgwfkenfqkekmlplgfpesffaegklqn
nvsfsrknvlrglhaepwdkyisvadggkvlgtwvdlregetfgntyqtvidasksifvp
rgvangfqvlsdfvaysylvndywalelkpkyafvnyadpsldikwenleeaevseaden
hpflkdvkplrkedl

SCOPe Domain Coordinates for d2ixlb_:

Click to download the PDB-style file with coordinates for d2ixlb_.
(The format of our PDB-style files is described here.)

Timeline for d2ixlb_: