SCOPe 2.08: Domain d2ixha2: 2ixh A:4-184

Lineage for d2ixha2 (2ixh A:4-184)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)

6. Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
   synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase

7. Species Pseudomonas aeruginosa [TaxId:287] [101972] (5 PDB entries)

8. Domain d2ixha2: 2ixh A:4-184 [137769]
   Other proteins in same PDB: d2ixha3, d2ixhb3
   automated match to d1rtva_
   complexed with trh

Details for d2ixha2

PDB Entry: 2ixh, 2 Å

PDB Description: rmlc p aeruginosa with dtdp-rhamnose

PDB Compounds: (A:) dtdp-4-dehydrorhamnose 3,5-epimerase

SCOPe Domain Sequences for d2ixha2:

Sequence; same for both SEQRES and ATOM records:

>d2ixha2 b.82.1.1 (A:4-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]}
mkatrlaipdvilfeprvfgddrgfffesynqrafeeacghpvsfvqdnhsrsargvlrg
lhyqirqaqgklvratlgevfdvavdlrrgsptfgqwvgerlsaenkrqmwipagfahgf
vvlseyaeflykttdfwapehercivwndpelkidwplqdapllsekdrqgkafadadcf
p

Timeline for d2ixha2:

• d2ixha2 first appeared in SCOP 1.73, called d2ixha1
  
• d2ixha2 appears in SCOPe 2.07