![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins) |
![]() | Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species) synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [101972] (5 PDB entries) |
![]() | Domain d2ixha2: 2ixh A:4-184 [137769] Other proteins in same PDB: d2ixha3, d2ixhb3 automated match to d1rtva_ complexed with trh |
PDB Entry: 2ixh (more details), 2 Å
SCOPe Domain Sequences for d2ixha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ixha2 b.82.1.1 (A:4-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} mkatrlaipdvilfeprvfgddrgfffesynqrafeeacghpvsfvqdnhsrsargvlrg lhyqirqaqgklvratlgevfdvavdlrrgsptfgqwvgerlsaenkrqmwipagfahgf vvlseyaeflykttdfwapehercivwndpelkidwplqdapllsekdrqgkafadadcf p
Timeline for d2ixha2: