SCOPe 2.04: Domain d2ix4a2: 2ix4 A:301-461

Lineage for d2ix4a2 (2ix4 A:301-461)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (9 proteins)

6. Protein Beta-ketoacyl-ACP synthase II [53909] (6 species)

7. Species Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId:3702] [117749] (2 PDB entries)
   Uniprot Q8L3X9

8. Domain d2ix4a2: 2ix4 A:301-461 [137760]
   automated match to d1w0ia2
   complexed with 6na, k

Details for d2ix4a2

PDB Entry: 2ix4, 1.95 Å

PDB Description: arabidopsis thaliana mitochondrial beta-ketoacyl acp synthase hexanoic acid complex

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d2ix4a2:

Sequence; same for both SEQRES and ATOM records:

>d2ix4a2 c.95.1.1 (A:301-461) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]}
yaelcgygmsgdahhitqppedgkgavlamtralrqsglcpnqidyvnahatstpigdav
earaiktvfsehatsgtlafsstkgatghllgaagaveaifsilaihhgvapmtlnvknp
dpifdkrfmplttskkmlvrtamsnsfgfggtnasllfasi

Timeline for d2ix4a2:

• d2ix4a2 first appeared in SCOP 1.73
  
• d2ix4a2 appears in SCOPe 2.03
  
• d2ix4a2 appears in SCOPe 2.05
  
• d2ix4a2 appears in the current release, SCOPe 2.08