Lineage for d2ivzc2 (2ivz C:35-162)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 994169Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 994287Superfamily c.51.2: TolB, N-terminal domain [52964] (1 family) (S)
  5. 994288Family c.51.2.1: TolB, N-terminal domain [52965] (1 protein)
  6. 994289Protein TolB, N-terminal domain [52966] (1 species)
  7. 994290Species Escherichia coli [TaxId:562] [52967] (4 PDB entries)
  8. 994297Domain d2ivzc2: 2ivz C:35-162 [137734]
    Other proteins in same PDB: d2ivza1, d2ivzb1, d2ivzc1, d2ivzd1
    automatically matched to d1crza2
    complexed with ca

Details for d2ivzc2

PDB Entry: 2ivz (more details), 2 Å

PDB Description: structure of tolb in complex with a peptide of the colicin e9 t-domain
PDB Compounds: (C:) protein tolb

SCOPe Domain Sequences for d2ivzc2:

Sequence, based on SEQRES records: (download)

>d2ivzc2 c.51.2.1 (C:35-162) TolB, N-terminal domain {Escherichia coli [TaxId: 562]}
grpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaawsa
lgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasdevf
ekltgikg

Sequence, based on observed residues (ATOM records): (download)

>d2ivzc2 c.51.2.1 (C:35-162) TolB, N-terminal domain {Escherichia coli [TaxId: 562]}
grpigvvpfqwapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaawsalgida
vvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasdevfekltg
ikg

SCOPe Domain Coordinates for d2ivzc2:

Click to download the PDB-style file with coordinates for d2ivzc2.
(The format of our PDB-style files is described here.)

Timeline for d2ivzc2: