SCOP 1.73: Domain d2ivzc2: 2ivz C:35-162

Lineage for d2ivzc2 (2ivz C:35-162)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (5 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.2: TolB, N-terminal domain [52964] (1 family)

5. Family c.51.2.1: TolB, N-terminal domain [52965] (1 protein)

6. Protein TolB, N-terminal domain [52966] (1 species)

7. Species Escherichia coli [TaxId:562] [52967] (4 PDB entries)

8. Domain d2ivzc2: 2ivz C:35-162 [137734]
   Other proteins in same PDB: d2ivza1, d2ivzb1, d2ivzc1, d2ivzd1
   automatically matched to d1crza2
   complexed with ca

Details for d2ivzc2

PDB Entry: 2ivz, 2 Å

PDB Description: structure of tolb in complex with a peptide of the colicin e9 t-domain

PDB Compounds: (C:) protein tolb

SCOP Domain Sequences for d2ivzc2:

Sequence, based on SEQRES records:

>d2ivzc2 c.51.2.1 (C:35-162) TolB, N-terminal domain {Escherichia coli [TaxId: 562]}
grpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaawsa
lgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasdevf
ekltgikg

Sequence, based on observed residues (ATOM records):

>d2ivzc2 c.51.2.1 (C:35-162) TolB, N-terminal domain {Escherichia coli [TaxId: 562]}
grpigvvpfqwapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaawsalgida
vvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasdevfekltg
ikg

Timeline for d2ivzc2:

• d2ivzc2 is new in SCOP 1.73
  
• d2ivzc2 appears in SCOP 1.75
  
• d2ivzc2 appears in the current release, SCOPe 2.08