Lineage for d2iuog2 (2iuo G:87-156)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524123Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
    intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. 2524124Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families) (S)
    automatically mapped to Pfam PF02560
  5. 2524125Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins)
    active form is a decamer formed by five dimers
  6. 2524148Protein automated matches [230795] (1 species)
    not a true protein
  7. 2524149Species Escherichia coli [TaxId:562] [230796] (6 PDB entries)
  8. 2524196Domain d2iuog2: 2iuo G:87-156 [137702]
    Other proteins in same PDB: d2iuoa1, d2iuob1, d2iuoc1, d2iuod1, d2iuoe1, d2iuof1, d2iuog1, d2iuoh1, d2iuoi1, d2iuoj1
    automated match to d1dwka2
    complexed with azi, br, cl, so4

Details for d2iuog2

PDB Entry: 2iuo (more details), 1.9 Å

PDB Description: Site Directed Mutagenesis of Key Residues Involved in the Catalytic Mechnism of Cyanase
PDB Compounds: (G:) cyanate hydratase

SCOPe Domain Sequences for d2iuog2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iuog2 d.72.1.1 (G:87-156) automated matches {Escherichia coli [TaxId: 562]}
riptdptmyrfyemlqvygttlkalvhekfgdgiigainfkldvkkvadpeggeravitl
dgkylptkpf

SCOPe Domain Coordinates for d2iuog2:

Click to download the PDB-style file with coordinates for d2iuog2.
(The format of our PDB-style files is described here.)

Timeline for d2iuog2: