PDB entry 2iuo

View 2iuo on RCSB PDB site
Description: Site Directed Mutagenesis of Key Residues Involved in the Catalytic Mechnism of Cyanase
Class: lyase
Keywords: lyase, cyanate degradation
Deposited on 2006-06-06, released 2006-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.152
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d2iuoa1, d2iuoa2
  • Chain 'B':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d2iuob1, d2iuob2
  • Chain 'C':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d2iuoc1, d2iuoc2
  • Chain 'D':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d2iuod1, d2iuod2
  • Chain 'E':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d2iuoe1, d2iuoe2
  • Chain 'F':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d2iuof1, d2iuof2
  • Chain 'G':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d2iuog1, d2iuog2
  • Chain 'H':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d2iuoh1, d2iuoh2
  • Chain 'I':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d2iuoi1, d2iuoi2
  • Chain 'J':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d2iuoj1, d2iuoj2
  • Heterogens: BR, CL, SO4, AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iuoA (A:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    igainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iuoB (B:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    igainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iuoC (C:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    igainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iuoD (D:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    igainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iuoE (E:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    igainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iuoF (F:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    igainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iuoG (G:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    igainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iuoH (H:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    igainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iuoI (I:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    igainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iuoJ (J:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    igainfkldvkkvadpeggeravitldgkylptkpf