Lineage for d2iuob2 (2iuo B:87-156)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
    intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families) (S)
    automatically mapped to Pfam PF02560
  5. Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins)
    active form is a decamer formed by five dimers
  6. Protein automated matches [230795] (1 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [230796] (6 PDB entries)
  8. Domain d2iuob2: 2iuo B:87-156 [137692]
    Other proteins in same PDB: d2iuoa1, d2iuob1, d2iuoc1, d2iuod1, d2iuoe1, d2iuof1, d2iuog1, d2iuoh1, d2iuoi1, d2iuoj1
    automated match to d1dwka2
    complexed with azi, br, cl, so4

Details for d2iuob2

PDB Entry: 2iuo (more details), 1.9 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase
PDB Compounds: (B:) cyanate hydratase

SCOPe Domain Sequences for d2iuob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iuob2 d.72.1.1 (B:87-156) automated matches {Escherichia coli [TaxId: 562]}
riptdptmyrfyemlqvygttlkalvhekfgdgiigainfkldvkkvadpeggeravitl
dgkylptkpf

SCOPe Domain Coordinates for d2iuob2 are not available.

Timeline for d2iuob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iuob1
View in 3D
Domains from other chains:
(mouse over for more information)
d2iuoa1, d2iuoa2, d2iuoc1, d2iuoc2, d2iuod1, d2iuod2, d2iuoe1, d2iuoe2, d2iuof1, d2iuof2, d2iuog1, d2iuog2, d2iuoh1, d2iuoh2, d2iuoi1, d2iuoi2, d2iuoj1, d2iuoj2