Class a: All alpha proteins [46456] (290 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.4: Cyanase N-terminal domain [47435] (2 proteins) probably does not bind to DNA |
Protein automated matches [230792] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [230793] (6 PDB entries) |
Domain d2iu7c1: 2iu7 C:1-86 [137653] Other proteins in same PDB: d2iu7a2, d2iu7b2, d2iu7c2, d2iu7d2, d2iu7e2, d2iu7f2, d2iu7g2, d2iu7h2, d2iu7i2, d2iu7j2 automated match to d1dwka1 complexed with oxl, so4 |
PDB Entry: 2iu7 (more details), 1.91 Å
SCOPe Domain Sequences for d2iu7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iu7c1 a.35.1.4 (C:1-86) automated matches {Escherichia coli [TaxId: 562]} miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl vgakldldedsilllqmiplrgcidd
Timeline for d2iu7c1: