Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily) intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta |
Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families) automatically mapped to Pfam PF02560 |
Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins) active form is a decamer formed by five dimers |
Protein automated matches [230795] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [230796] (6 PDB entries) |
Domain d2iu7i2: 2iu7 I:87-156 [137666] Other proteins in same PDB: d2iu7a1, d2iu7b1, d2iu7c1, d2iu7d1, d2iu7e1, d2iu7f1, d2iu7g1, d2iu7h1, d2iu7i1, d2iu7j1 automated match to d1dwka2 complexed with oxl, so4 |
PDB Entry: 2iu7 (more details), 1.91 Å
SCOPe Domain Sequences for d2iu7i2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iu7i2 d.72.1.1 (I:87-156) automated matches {Escherichia coli [TaxId: 562]} riptdptmfrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl dgkylptkpf
Timeline for d2iu7i2: