SCOPe 2.01: Domain d2it6a1: 2it6 A:253-384

Lineage for d2it6a1 (2it6 A:253-384)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) [69855] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69856] (6 PDB entries)
   Uniprot Q9NNX6 253-384

8. Domain d2it6a1: 2it6 A:253-384 [137633]
   automatically matched to d1k9id_
   complexed with ca

Details for d2it6a1

PDB Entry: 2it6, 1.95 Å

PDB Description: crystal structure of dcsign-crd with man2

PDB Compounds: (A:) CD209 antigen

SCOPe Domain Sequences for d2it6a1:

Sequence; same for both SEQRES and ATOM records:

>d2it6a1 d.169.1.1 (A:253-384) DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) {Human (Homo sapiens) [TaxId: 9606]}
chpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnr
ftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnla
kfwickksaasc

Timeline for d2it6a1:

• d2it6a1 first appeared in SCOP 1.73
  
• d2it6a1 appears in SCOP 1.75
  
• d2it6a1 appears in SCOPe 2.02
  
• d2it6a1 appears in the current release, SCOPe 2.08, called d2it6a_