Lineage for d2it6a_ (2it6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001374Protein DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) [69855] (1 species)
  7. 3001375Species Human (Homo sapiens) [TaxId:9606] [69856] (7 PDB entries)
    Uniprot Q9NNX6 253-384
  8. 3001378Domain d2it6a_: 2it6 A: [137633]
    automated match to d1sl4a_
    complexed with ca

Details for d2it6a_

PDB Entry: 2it6 (more details), 1.95 Å

PDB Description: crystal structure of dcsign-crd with man2
PDB Compounds: (A:) CD209 antigen

SCOPe Domain Sequences for d2it6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2it6a_ d.169.1.1 (A:) DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) {Human (Homo sapiens) [TaxId: 9606]}
chpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnr
ftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnla
kfwickksaasc

SCOPe Domain Coordinates for d2it6a_:

Click to download the PDB-style file with coordinates for d2it6a_.
(The format of our PDB-style files is described here.)

Timeline for d2it6a_: