SCOPe 2.06: Domain d2isyb2: 2isy B:65-140

Lineage for d2isyb2 (2isy B:65-140)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families)
   automatically mapped to Pfam PF02742

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)

6. Protein Iron-dependent regulator [47983] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries)
   Uniprot Q50495

8. Domain d2isyb2: 2isy B:65-140 [137615]
   Other proteins in same PDB: d2isya1, d2isya3, d2isyb1, d2isyb3
   automated match to d2isyb2
   complexed with ni, po4

Details for d2isyb2

PDB Entry: 2isy, 1.96 Å

PDB Description: crystal structure of the nickel-activated two-domain iron-dependent regulator (ider)

PDB Compounds: (B:) iron-dependent repressor ider

SCOPe Domain Sequences for d2isyb2:

Sequence; same for both SEQRES and ATOM records:

>d2isyb2 a.76.1.1 (B:65-140) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]}
tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt
tspfgnpipglvelgv

Timeline for d2isyb2:

• d2isyb2 first appeared in SCOP 1.73
  
• d2isyb2 appears in SCOPe 2.05
  
• d2isyb2 appears in SCOPe 2.07
  
• d2isyb2 appears in the current release, SCOPe 2.08