Lineage for d2isyb2 (2isy B:65-140)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718817Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2718818Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 2718819Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)
  6. 2718855Protein Iron-dependent regulator [47983] (1 species)
  7. 2718856Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries)
    Uniprot Q50495
  8. 2718858Domain d2isyb2: 2isy B:65-140 [137615]
    Other proteins in same PDB: d2isya1, d2isya3, d2isyb1, d2isyb3
    automated match to d2isyb2
    complexed with ni, po4

Details for d2isyb2

PDB Entry: 2isy (more details), 1.96 Å

PDB Description: crystal structure of the nickel-activated two-domain iron-dependent regulator (ider)
PDB Compounds: (B:) iron-dependent repressor ider

SCOPe Domain Sequences for d2isyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2isyb2 a.76.1.1 (B:65-140) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]}
tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt
tspfgnpipglvelgv

SCOPe Domain Coordinates for d2isyb2:

Click to download the PDB-style file with coordinates for d2isyb2.
(The format of our PDB-style files is described here.)

Timeline for d2isyb2: