SCOP 1.73: Domain d2ipkd2: 2ipk D:122-239

Lineage for d2ipkd2 (2ipk D:122-239)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54345] (11 PDB entries)

8. Domain d2ipkd2: 2ipk D:122-239 [137582]
   Other proteins in same PDB: d2ipka1, d2ipka2, d2ipkb1, d2ipkb2, d2ipkd1
   automatically matched to d1jwmd2
   complexed with 4dp, ace; mutant

Details for d2ipkd2

PDB Entry: 2ipk, 2.3 Å

PDB Description: crystal structure of the mhc class ii molecule hla-dr1 in complex with the fluorogenic peptide, acpkxvkqntlklat (x=3-[5-(dimethylamino)-1,3- dioxo-1,3-dihydro-2h-isoindol-2-yl]-l-alanine) and the superantigen, sec3 variant 3b2

PDB Compounds: (D:) Enterotoxin type C-3

SCOP Domain Sequences for d2ipkd2:

Sequence; same for both SEQRES and ATOM records:

>d2ipkd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

Timeline for d2ipkd2:

• d2ipkd2 is new in SCOP 1.73
  
• d2ipkd2 appears in SCOP 1.75
  
• d2ipkd2 appears in the current release, SCOPe 2.08