SCOP 1.73: Domain d2ipkb1: 2ipk B:93-190

Lineage for d2ipkb1 (2ipk B:93-190)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (38 PDB entries)
   probably orthologous to the mouse I-E group

8. Domain d2ipkb1: 2ipk B:93-190 [137579]
   Other proteins in same PDB: d2ipka1, d2ipka2, d2ipkb2, d2ipkd1, d2ipkd2
   automatically matched to d1d5xb1
   complexed with 4dp, ace; mutant

Details for d2ipkb1

PDB Entry: 2ipk, 2.3 Å

PDB Description: crystal structure of the mhc class ii molecule hla-dr1 in complex with the fluorogenic peptide, acpkxvkqntlklat (x=3-[5-(dimethylamino)-1,3- dioxo-1,3-dihydro-2h-isoindol-2-yl]-l-alanine) and the superantigen, sec3 variant 3b2

PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOP Domain Sequences for d2ipkb1:

Sequence; same for both SEQRES and ATOM records:

>d2ipkb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Timeline for d2ipkb1:

• d2ipkb1 is new in SCOP 1.73
  
• d2ipkb1 appears in SCOP 1.75
  
• d2ipkb1 appears in the current release, SCOPe 2.08