Lineage for d2iona1 (2ion A:322-450)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1500528Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1500885Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
    this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain
  6. 1500922Protein Programmed cell death 4, PDCD4 [140815] (1 species)
  7. 1500923Species Mouse (Mus musculus) [TaxId:10090] [140816] (5 PDB entries)
    Uniprot Q61823 322-448! Uniprot Q61823 322-450
  8. 1500925Domain d2iona1: 2ion A:322-450 [137575]
    2nd MA3 domain
    complexed with gol

Details for d2iona1

PDB Entry: 2ion (more details), 1.57 Å

PDB Description: crystal structure of the c-terminal ma3 domain of pdcd4 (mouse); form2
PDB Compounds: (A:) Programmed Cell Death 4, Pdcd4

SCOPe Domain Sequences for d2iona1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iona1 a.118.1.14 (A:322-450) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]}
qpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesafk
mildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagiisk
qlrdlcpsr

SCOPe Domain Coordinates for d2iona1:

Click to download the PDB-style file with coordinates for d2iona1.
(The format of our PDB-style files is described here.)

Timeline for d2iona1: