![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein SUMO-1 (smt3 homologue) [54241] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54242] (10 PDB entries) Uniprot Q93068 |
![]() | Domain d2io2b_: 2io2 B: [137540] Other proteins in same PDB: d2io2a_, d2io2c1 automated match to d2ckhb1 |
PDB Entry: 2io2 (more details), 2.9 Å
SCOPe Domain Sequences for d2io2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2io2b_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} klkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkelgm eeedvievyqeqtgg
Timeline for d2io2b_: