Lineage for d2io2b_ (2io2 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2538611Protein SUMO-1 (smt3 homologue) [54241] (3 species)
  7. 2538619Species Human (Homo sapiens) [TaxId:9606] [54242] (10 PDB entries)
    Uniprot Q93068
  8. 2538625Domain d2io2b_: 2io2 B: [137540]
    Other proteins in same PDB: d2io2a_, d2io2c1
    automated match to d2ckhb1

Details for d2io2b_

PDB Entry: 2io2 (more details), 2.9 Å

PDB Description: crystal structure of human senp2 in complex with rangap1-sumo-1
PDB Compounds: (B:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d2io2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io2b_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
klkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkelgm
eeedvievyqeqtgg

SCOPe Domain Coordinates for d2io2b_:

Click to download the PDB-style file with coordinates for d2io2b_.
(The format of our PDB-style files is described here.)

Timeline for d2io2b_: