Lineage for d2ijd12 (2ijd 1:184-644)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 884269Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 884270Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 884709Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (2 proteins)
  6. 884717Protein Viral RNA polymerase [56695] (10 species)
  7. 884789Species Poliovirus type 1, strain Mahoney [TaxId:12080] [56696] (12 PDB entries)
    Uniprot P03300 1748-2208
  8. 884800Domain d2ijd12: 2ijd 1:184-644 [137475]
    Other proteins in same PDB: d2ijd11, d2ijd21
    automatically matched to d1ra6a_
    complexed with so4, zn; mutant

Details for d2ijd12

PDB Entry: 2ijd (more details), 3.4 Å

PDB Description: crystal structure of the poliovirus precursor protein 3cd
PDB Compounds: (1:) Picornain 3C, RNA-directed RNA polymerase

SCOP Domain Sequences for d2ijd12:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ijd12 e.8.1.4 (1:184-644) Viral RNA polymerase {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi
nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
awhngeeeynkflakirsvpigraldlpeystlydrwldsf

SCOP Domain Coordinates for d2ijd12:

Click to download the PDB-style file with coordinates for d2ijd12.
(The format of our PDB-style files is described here.)

Timeline for d2ijd12:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ijd11