SCOPe 2.08: Domain d2ijcc_: 2ijc C:

Lineage for d2ijcc_ (2ijc C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (4 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.3: Atu0492-like [140970] (6 proteins)
   duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family

6. Protein Hypothetical protein PA0269 [140973] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [140974] (2 PDB entries)
   Uniprot Q9I6M1 2-144! Uniprot Q9I6M1 2-145

8. Domain d2ijcc_: 2ijc C: [137467]
   automated match to d2o4da1

Details for d2ijcc_

PDB Entry: 2ijc, 2.05 Å

PDB Description: Structure of a Conserved Protein of Unknown Function PA0269 from Pseudomonas aeruginosa

PDB Compounds: (C:) hypothetical protein

SCOPe Domain Sequences for d2ijcc_:

Sequence; same for both SEQRES and ATOM records:

>d2ijcc_ a.152.1.3 (C:) Hypothetical protein PA0269 {Pseudomonas aeruginosa [TaxId: 287]}
trlewakaspdayaamlglekalakaglerplielvylrtsqingcaycvnmhandarka
geteqrlqalcvwqetpyftpreraalawteqlarlsqgalphglldelrehfddkeiae
ltlavsainawnrfgvgmgmqp

Timeline for d2ijcc_:

• d2ijcc_ first appeared in SCOP 1.73, called d2ijcc1
  
• d2ijcc_ appears in SCOPe 2.07